Lineage for d1bby__ (1bby -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277839Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 278013Family a.4.5.15: DNA-binding domain from rap30 [46841] (1 protein)
  6. 278014Protein DNA-binding domain from rap30 [46842] (1 species)
  7. 278015Species Human (Homo sapiens) [TaxId:9606] [46843] (2 PDB entries)
  8. 278017Domain d1bby__: 1bby - [16149]

Details for d1bby__

PDB Entry: 1bby (more details)

PDB Description: dna-binding domain from human rap30, nmr, minimized average

SCOP Domain Sequences for d1bby__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bby__ a.4.5.15 (-) DNA-binding domain from rap30 {Human (Homo sapiens)}
raradkqhvldmlfsafekhqyynlkdlvditkqpvvylkeilkeigvqnvkgihkntwe
lkpeyrhyq

SCOP Domain Coordinates for d1bby__:

Click to download the PDB-style file with coordinates for d1bby__.
(The format of our PDB-style files is described here.)

Timeline for d1bby__: