![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.15: DNA-binding domain from rap30 [46841] (1 protein) automatically mapped to Pfam PF02270 |
![]() | Protein DNA-binding domain from rap30 [46842] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46843] (2 PDB entries) |
![]() | Domain d1bbya_: 1bby A: [16149] |
PDB Entry: 1bby (more details)
SCOPe Domain Sequences for d1bbya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbya_ a.4.5.15 (A:) DNA-binding domain from rap30 {Human (Homo sapiens) [TaxId: 9606]} raradkqhvldmlfsafekhqyynlkdlvditkqpvvylkeilkeigvqnvkgihkntwe lkpeyrhyq
Timeline for d1bbya_: