Lineage for d2o5io_ (2o5i O:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734752Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 2734753Protein RNA polymerase omega subunit [63564] (3 species)
  7. 2734758Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries)
  8. 2734764Domain d2o5io_: 2o5i O: [161489]
    Other proteins in same PDB: d2o5ia1, d2o5ia2, d2o5ib1, d2o5ib2, d2o5ic_, d2o5id_, d2o5ik1, d2o5ik2, d2o5il1, d2o5il2, d2o5im_, d2o5in_
    automated match to d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2o5io_

PDB Entry: 2o5i (more details), 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase elongation complex
PDB Compounds: (O:) DNA-directed RNA polymerase omega chain

SCOPe Domain Sequences for d2o5io_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5io_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypve

SCOPe Domain Coordinates for d2o5io_:

Click to download the PDB-style file with coordinates for d2o5io_.
(The format of our PDB-style files is described here.)

Timeline for d2o5io_: