Lineage for d2o34b_ (2o34 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035940Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1036380Superfamily d.96.2: ApbE-like [143631] (2 families) (S)
    duplication: contains two differently decorated beta(2)-alpha(2)-beta(2) subdomains, similar to other T-fold domains; probably does not form the tunnel-shaped oligomers
  5. 1036385Family d.96.2.2: DVU1097-like [160566] (2 proteins)
    Pfam PF04040; DUF375
  6. 1036389Protein automated matches [190751] (1 species)
    not a true protein
  7. 1036390Species Desulfovibrio vulgaris [TaxId:881] [187946] (1 PDB entry)
  8. 1036391Domain d2o34b_: 2o34 B: [161484]
    Other proteins in same PDB: d2o34a1
    automated match to d2o34a1
    complexed with na

Details for d2o34b_

PDB Entry: 2o34 (more details), 1.95 Å

PDB Description: crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2o34b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o34b_ d.96.2.2 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 881]}
arregetvfqvvveetdlrvtalaelatpmaayvgelraqlkvwmefqpafrhslvpvev
pegapevvrrmahgarlvgvgpfaavagtiaqmvaerfvdvspelivenggdlylyserd
rvvgilpdpasgdmvgilvragtapvslcgssarighslslgdgdlavvrardasladaa
atafgnmlrraddvaavteraaqlasigiegvyaqcggrigiwgdmelava

SCOPe Domain Coordinates for d2o34b_:

Click to download the PDB-style file with coordinates for d2o34b_.
(The format of our PDB-style files is described here.)

Timeline for d2o34b_: