| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.2: ApbE-like [143631] (2 families) ![]() duplication: contains two differently decorated beta(2)-alpha(2)-beta(2) subdomains, similar to other T-fold domains; probably does not form the tunnel-shaped oligomers |
| Family d.96.2.2: DVU1097-like [160566] (2 proteins) Pfam PF04040; DUF375 |
| Protein automated matches [190751] (1 species) not a true protein |
| Species Desulfovibrio vulgaris [TaxId:881] [187946] (1 PDB entry) |
| Domain d2o34b_: 2o34 B: [161484] Other proteins in same PDB: d2o34a1, d2o34a2 automated match to d2o34a1 complexed with na |
PDB Entry: 2o34 (more details), 1.95 Å
SCOPe Domain Sequences for d2o34b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o34b_ d.96.2.2 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 881]}
arregetvfqvvveetdlrvtalaelatpmaayvgelraqlkvwmefqpafrhslvpvev
pegapevvrrmahgarlvgvgpfaavagtiaqmvaerfvdvspelivenggdlylyserd
rvvgilpdpasgdmvgilvragtapvslcgssarighslslgdgdlavvrardasladaa
atafgnmlrraddvaavteraaqlasigiegvyaqcggrigiwgdmelava
Timeline for d2o34b_: