| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest |
Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) ![]() |
| Family c.140.1.2: Aminoglycoside 3-N-acetyltransferase-like [159765] (1 protein) Pfam PF02522; CoA-dependent enzymes |
| Protein Uncharacterized protein YokD [159766] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [159767] (1 PDB entry) Uniprot O32003 2-271 |
| Domain d2nyge_: 2nyg E: [161481] Other proteins in same PDB: d2nyga2, d2nygc3, d2nygd3 automated match to d2nyga1 complexed with coa |
PDB Entry: 2nyg (more details), 2.6 Å
SCOPe Domain Sequences for d2nyge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nyge_ c.140.1.2 (E:) Uncharacterized protein YokD {Bacillus subtilis [TaxId: 1423]}
prtkqsitedlkalglkkgmtvlvhsslssigwvnggavaviqalidvvteegtivmpsq
svelsdpkewgnppvpeewwdiiresmpaynsnytpttrgmgqivelfrsypevkrsnhp
nysfvawgkhknkilnqhplefglgeqsplgklyiresyvlllgadfdsstcfhlaeyri
pyqkiinrgapiivegkrvwkeykelefreelfqevgqafeaehnmkvgkvgsancrlfs
lteavdfaekwfinndskni
Timeline for d2nyge_: