Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (17 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries) |
Domain d2jj0m_: 2jj0 M: [161479] Other proteins in same PDB: d2jj0h1, d2jj0h2 automated match to d1ystm_ complexed with bcl, bph, cdl, cl, fe, spn, u10; mutant |
PDB Entry: 2jj0 (more details), 2.8 Å
SCOPe Domain Sequences for d2jj0m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj0m_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} eyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslf sglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasff mfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifs hldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadr gtaaerwalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh g
Timeline for d2jj0m_: