Lineage for d2j9zb_ (2j9z B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387142Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1387143Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1387144Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1387367Protein automated matches [190054] (8 species)
    not a true protein
  7. 1387386Species Salmonella typhimurium [TaxId:90371] [189633] (14 PDB entries)
  8. 1387396Domain d2j9zb_: 2j9z B: [161476]
    Other proteins in same PDB: d2j9za_
    automated match to d2tysb_
    complexed with na, plp; mutant

Details for d2j9zb_

PDB Entry: 2j9z (more details), 1.8 Å

PDB Description: tryptophan synthase t110 mutant complex
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d2j9zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9zb_ c.79.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaevgagnhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkar

SCOPe Domain Coordinates for d2j9zb_:

Click to download the PDB-style file with coordinates for d2j9zb_.
(The format of our PDB-style files is described here.)

Timeline for d2j9zb_: