SCOPe 2.08: Domain d2j9lf1: 2j9l F:578-746

Lineage for d2j9lf1 (2j9l F:578-746)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein automated matches [190627] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187902] (3 PDB entries)

8. Domain d2j9lf1: 2j9l F:578-746 [161473]
   Other proteins in same PDB: d2j9la1, d2j9la2, d2j9lb2, d2j9lc2, d2j9ld2, d2j9le2, d2j9lf2
   automated match to d2j9la1
   complexed with atp, cl

Details for d2j9lf1

PDB Entry: 2j9l, 2.3 Å

PDB Description: cytoplasmic domain of the human chloride transporter clc-5 in complex with atp

PDB Compounds: (F:) chloride channel protein 5

SCOPe Domain Sequences for d2j9lf1:

Sequence, based on SEQRES records:

>d2j9lf1 d.37.1.1 (F:578-746) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr
rdliisienarkkqdgvvstsiiyftehspplppytpptlklrnildlspftvtdltpme
ivvdifrklglrqclvthngrllgiitkkdvlkhiaqmanqdpdsilfn

Sequence, based on observed residues (ATOM records):

>d2j9lf1 d.37.1.1 (F:578-746) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr
rdliisienarkgvvstsiiyftehspplppytpptlklrnildlspftvtdltpmeivv
difrklglrqclvthngrllgiitkkdvlkhiaqmilfn

Timeline for d2j9lf1:

• d2j9lf1 first appeared in SCOPe 2.01, called d2j9lf_
  
• d2j9lf1 appears in SCOPe 2.07