Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein automated matches [190627] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187902] (3 PDB entries) |
Domain d2j9lc1: 2j9l C:578-746 [161470] Other proteins in same PDB: d2j9la1, d2j9la2, d2j9lb2, d2j9lc2, d2j9ld2, d2j9le2, d2j9lf2 automated match to d2j9la1 complexed with atp, cl |
PDB Entry: 2j9l (more details), 2.3 Å
SCOPe Domain Sequences for d2j9lc1:
Sequence, based on SEQRES records: (download)
>d2j9lc1 d.37.1.1 (C:578-746) automated matches {Human (Homo sapiens) [TaxId: 9606]} hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr rdliisienarkkqdgvvstsiiyftehspplppytpptlklrnildlspftvtdltpme ivvdifrklglrqclvthngrllgiitkkdvlkhiaqmanqdpdsilfn
>d2j9lc1 d.37.1.1 (C:578-746) automated matches {Human (Homo sapiens) [TaxId: 9606]} hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr rdliisienarkkqdgvvstsiiyftehspplppytpptlklrnildlspftvtdltpme ivvdifrklglrqclvthngrllgiitkkdvlkhiaqmanqlfn
Timeline for d2j9lc1: