Lineage for d2j3wd_ (2j3w D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615343Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 2615344Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) (S)
  5. 2615395Family d.278.1.2: TRAPP components [118076] (3 proteins)
    Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold
  6. 2615405Protein automated matches [190535] (2 species)
    not a true protein
  7. 2615412Species Mouse (Mus musculus) [TaxId:10090] [187891] (4 PDB entries)
  8. 2615415Domain d2j3wd_: 2j3w D: [161467]
    Other proteins in same PDB: d2j3wa_, d2j3wb1, d2j3wc_, d2j3wf_
    automated match to d1wc8a_
    complexed with plm

Details for d2j3wd_

PDB Entry: 2j3w (more details), 2.1 Å

PDB Description: The crystal structure of the bet3-trs31-sedlin complex.
PDB Compounds: (D:) Trafficking protein particle complex subunit 3

SCOPe Domain Sequences for d2j3wd_:

Sequence, based on SEQRES records: (download)

>d2j3wd_ d.278.1.2 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdfr
etadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllc
gvlrgalemvqmaveakfvqdtlkgdgvteirmrfirried

Sequence, based on observed residues (ATOM records): (download)

>d2j3wd_ d.278.1.2 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnchdfreta
dviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllcgvl
rgalemvqmaveakfvqdtlkgdgvteirmrfirried

SCOPe Domain Coordinates for d2j3wd_:

Click to download the PDB-style file with coordinates for d2j3wd_.
(The format of our PDB-style files is described here.)

Timeline for d2j3wd_: