SCOPe 2.08: Domain d2ijqb_: 2ijq B:

Lineage for d2ijqb_ (2ijq B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.2: TTHA0068-like [140663] (1 family)

5. Family a.246.2.1: TTHA0068-like [140664] (3 proteins)
   Pfam PF03745; DUF309

6. Protein automated matches [190577] (2 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:2238] [187864] (1 PDB entry)

8. Domain d2ijqb_: 2ijq B: [161463]
   Other proteins in same PDB: d2ijqa1
   automated match to d2ijqa1

Details for d2ijqb_

PDB Entry: 2ijq, 1.88 Å

PDB Description: crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2ijqb_:

Sequence; same for both SEQRES and ATOM records:

>d2ijqb_ a.246.2.1 (B:) automated matches {Haloarcula marismortui [TaxId: 2238]}
wehetlrravvhgvrlynsgefheshdcfedewynygrgnteskflhgmvqvaagaykhf
dfedddgmrslfrtslqyfrgvpndyygvdlldvrttvtnalsdpsalhgwqirldge

Timeline for d2ijqb_:

• d2ijqb_ first appeared in SCOPe 2.01
  
• d2ijqb_ appears in SCOPe 2.07