Lineage for d2hdca_ (2hdc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693299Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2693310Protein Genesis [46837] (1 species)
  7. 2693311Species Norway rat (Rattus norvegicus) [TaxId:10116] [46838] (2 PDB entries)
  8. 2693313Domain d2hdca_: 2hdc A: [16146]
    protein/DNA complex

Details for d2hdca_

PDB Entry: 2hdc (more details)

PDB Description: structure of transcription factor genesis/dna complex
PDB Compounds: (A:) protein (transcription factor)

SCOPe Domain Sequences for d2hdca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hdca_ a.4.5.14 (A:) Genesis {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vkppysyialitmailqspqkkltlsgicefisnrfpyyrekfpawqnsirhnlslndcf
vkiprepgnpgkgnywtldpqsedmfdngsflrrrkr

SCOPe Domain Coordinates for d2hdca_:

Click to download the PDB-style file with coordinates for d2hdca_.
(The format of our PDB-style files is described here.)

Timeline for d2hdca_: