SCOPe 2.01: Domain d2htmb_: 2htm B:

Lineage for d2htmb_ (2htm B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.31: ThiG-like [110399] (2 families)
   shares the common phosphate-binding site with other superfamilies

5. Family c.1.31.0: automated matches [191453] (1 protein)
   not a true family

6. Protein automated matches [190693] (1 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [187825] (1 PDB entry)

8. Domain d2htmb_: 2htm B: [161454]
   Other proteins in same PDB: d2htme_, d2htmf_, d2htmg_, d2htmh_
   automated match to d1xm3a_

Details for d2htmb_

PDB Entry: 2htm, 2.3 Å

PDB Description: Crystal structure of TTHA0676 from Thermus thermophilus HB8

PDB Compounds: (B:) Thiazole biosynthesis protein thiG

SCOPe Domain Sequences for d2htmb_:

Sequence, based on SEQRES records:

>d2htmb_ c.1.31.0 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
mdtwkvgpvelksrlilgsgkyedfgvmreaiaaakaevvtvsvrrvelkapghvgllea
legvrllpntagartaeeavrlarlgrlltgerwvklevipdptyllpdpletlkaaerl
ieedflvlpymgpdlvlakrlaalgtatvmplaapigsgwgvrtrallelfarekaslpp
vvvdaglglpshaaevmelgldavlvntaiaeaqdppamaeafrlaveagrkaylagpmr
p

Sequence, based on observed residues (ATOM records):

>d2htmb_ c.1.31.0 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
mdtwkvgpvelksrlilgsgkyedfgvmreaiaaakaevvtvsvrrvgllealegvrllp
ntagartaeeavrlarlgrlltgerwvklevipdptyllpdpletlkaaerlieedflvl
pymgpdlvlakrlaalgtatvmplaapigsgwgvrtrallelfarekaslppvvvdaglg
lpshaaevmelgldavlvntaiaeaqdppamaeafrlaveagrkaylagpmrp

Timeline for d2htmb_:

• d2htmb_ is new in SCOPe 2.01-stable
  
• d2htmb_ appears in SCOPe 2.02
  
• d2htmb_ appears in the current release, SCOPe 2.08