Lineage for d2h5nc_ (2h5n C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2021080Fold a.287: TerB-like [158681] (1 superfamily)
    multihelical; contains two central helices; duplication: there are two three-helical repeats related by pseudo twofold symmetry
  4. 2021081Superfamily a.287.1: TerB-like [158682] (2 families) (S)
    members of this superfamily probably related to the tellurite resistance protein TerB (Pfam PF05099) of yet undetermined structure
  5. 2021087Family a.287.1.2: PG1108-like [158686] (1 protein)
    automatically mapped to Pfam PF05099
  6. 2021088Protein Hypothetical protein PG1108 [158687] (1 species)
  7. 2021089Species Porphyromonas gingivalis [TaxId:837] [158688] (1 PDB entry)
    Uniprot Q7MVF6 1-132
  8. 2021092Domain d2h5nc_: 2h5n C: [161450]
    automated match to d2h5na1
    complexed with mg

Details for d2h5nc_

PDB Entry: 2h5n (more details), 2.01 Å

PDB Description: Crystal Structure of Protein of Unknown Function PG1108 from Porphyromonas gingivalis W83
PDB Compounds: (C:) Hypothetical protein PG_1108

SCOPe Domain Sequences for d2h5nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5nc_ a.287.1.2 (C:) Hypothetical protein PG1108 {Porphyromonas gingivalis [TaxId: 837]}
imtfsgqeltaiikmaksmvmadgkikpaeiavmtrefmrfgilqdqvdlllkasdsiea
sqavaliarmdeerkkyvasylgvimasdgdiddnelalwtlistlcglptmtvmeainn
mknl

SCOPe Domain Coordinates for d2h5nc_:

Click to download the PDB-style file with coordinates for d2h5nc_.
(The format of our PDB-style files is described here.)

Timeline for d2h5nc_: