Lineage for d2hfha_ (2hfh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693299Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2693310Protein Genesis [46837] (1 species)
  7. 2693311Species Norway rat (Rattus norvegicus) [TaxId:10116] [46838] (2 PDB entries)
  8. 2693312Domain d2hfha_: 2hfh A: [16145]

Details for d2hfha_

PDB Entry: 2hfh (more details)

PDB Description: the nmr structures of a winged helix protein: genesis, 20 structures
PDB Compounds: (A:) genesis

SCOPe Domain Sequences for d2hfha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfha_ a.4.5.14 (A:) Genesis {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mvkppysyialitmailqspqkkltlsgicefisnrfpyyrekfpawqnsirhnlslndc
fvkiprepgnpgkgnywtldpqsedmfdngsfl

SCOPe Domain Coordinates for d2hfha_:

Click to download the PDB-style file with coordinates for d2hfha_.
(The format of our PDB-style files is described here.)

Timeline for d2hfha_: