SCOPe 2.08: Domain d2hfha_: 2hfh A:

Lineage for d2hfha_ (2hfh A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)

6. Protein Genesis [46837] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [46838] (2 PDB entries)

8. Domain d2hfha_: 2hfh A: [16145]

Details for d2hfha_

PDB Entry: 2hfh

PDB Description: the nmr structures of a winged helix protein: genesis, 20 structures

PDB Compounds: (A:) genesis

SCOPe Domain Sequences for d2hfha_:

Sequence; same for both SEQRES and ATOM records:

>d2hfha_ a.4.5.14 (A:) Genesis {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mvkppysyialitmailqspqkkltlsgicefisnrfpyyrekfpawqnsirhnlslndc
fvkiprepgnpgkgnywtldpqsedmfdngsfl

Timeline for d2hfha_:

• d2hfha_ first appeared (with stable ids) in SCOP 1.55, called d2hfh__
  
• d2hfha_ appears in SCOPe 2.07