SCOPe 2.07: Domain d2gzia_: 2gzi A:

Lineage for d2gzia_ (2gzi A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE9 protein (Im9) [47351] (1 species)

7. Species Escherichia coli [TaxId:562] [47352] (18 PDB entries)

8. Domain d2gzia_: 2gzi A: [161448]
   Other proteins in same PDB: d2gzib_
   automated match to d1e0ha_
   protein/DNA complex; complexed with po4, zn; mutant

Details for d2gzia_

PDB Entry: 2gzi, 1.7 Å

PDB Description: crystal structure of the e9 dnase domain with a mutant immunity protein im9 (v34a)

PDB Compounds: (A:) colicin-e9 immunity protein

SCOPe Domain Sequences for d2gzia_:

Sequence; same for both SEQRES and ATOM records:

>d2gzia_ a.28.2.1 (A:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflqlvtticnadtsseeelaklvthfeemtehpsgsdliyypkegddd
spsgivntvkqwraangksgfkq

Timeline for d2gzia_:

• d2gzia_ first appeared in SCOPe 2.01
  
• d2gzia_ appears in SCOPe 2.06
  
• d2gzia_ appears in the current release, SCOPe 2.08