Lineage for d2gzea_ (2gze A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706394Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 2706395Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 2706421Protein ImmE9 protein (Im9) [47351] (1 species)
  7. 2706422Species Escherichia coli [TaxId:562] [47352] (18 PDB entries)
  8. 2706434Domain d2gzea_: 2gze A: [161445]
    Other proteins in same PDB: d2gzeb_
    automated match to d1e0ha_
    complexed with po4, zn; mutant

Details for d2gzea_

PDB Entry: 2gze (more details), 1.8 Å

PDB Description: crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y55a)
PDB Compounds: (A:) colicin-e9 immunity protein

SCOPe Domain Sequences for d2gzea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzea_ a.28.2.1 (A:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
khsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsdliyapkegddds
psgivntvkqwraangksgfkq

SCOPe Domain Coordinates for d2gzea_:

Click to download the PDB-style file with coordinates for d2gzea_.
(The format of our PDB-style files is described here.)

Timeline for d2gzea_: