SCOPe 2.05: Domain d2gtpd_: 2gtp D:

Lineage for d2gtpd_ (2gtp D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)

8. Domain d2gtpd_: 2gtp D: [161443]
   Other proteins in same PDB: d2gtpa1, d2gtpa2, d2gtpb1, d2gtpb2
   automated match to d2jm5a1
   complexed with alf, gdp, mg

Details for d2gtpd_

PDB Entry: 2gtp, 2.55 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS1 and activated Gi alpha 1

PDB Compounds: (D:) Regulator of G-protein signaling 1

SCOPe Domain Sequences for d2gtpd_:

Sequence; same for both SEQRES and ATOM records:

>d2gtpd_ a.91.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlacedykktesdllpck
aeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviytlmekdsyprflk
sdiylnllndlq

Timeline for d2gtpd_:

• d2gtpd_ first appeared in SCOPe 2.01
  
• d2gtpd_ appears in SCOPe 2.04
  
• d2gtpd_ appears in SCOPe 2.06
  
• d2gtpd_ appears in the current release, SCOPe 2.08