Lineage for d2grra_ (2grr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939126Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (29 PDB entries)
    identical sequence in many other species
  8. 2939129Domain d2grra_: 2grr A: [161441]
    Other proteins in same PDB: d2grrb_
    automated match to d1u9aa_

Details for d2grra_

PDB Entry: 2grr (more details), 1.3 Å

PDB Description: crystal structure of human rangap1-ubc9-d127s
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 I

SCOPe Domain Sequences for d2grra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grra_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]}
msgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl
rmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqell
nepniqspaqaeaytiycqnrveyekrvraqakkfap

SCOPe Domain Coordinates for d2grra_:

Click to download the PDB-style file with coordinates for d2grra_.
(The format of our PDB-style files is described here.)

Timeline for d2grra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2grrb_