SCOPe 2.08: Domain d2grra_: 2grr A:

Lineage for d2grra_ (2grr A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (29 PDB entries)
   identical sequence in many other species

8. Domain d2grra_: 2grr A: [161441]
   Other proteins in same PDB: d2grrb_
   automated match to d1u9aa_

Details for d2grra_

PDB Entry: 2grr, 1.3 Å

PDB Description: crystal structure of human rangap1-ubc9-d127s

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 I

SCOPe Domain Sequences for d2grra_:

Sequence; same for both SEQRES and ATOM records:

>d2grra_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]}
msgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl
rmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqell
nepniqspaqaeaytiycqnrveyekrvraqakkfap

Timeline for d2grra_:

• d2grra_ first appeared in SCOPe 2.01
  
• d2grra_ appears in SCOPe 2.07