Lineage for d1d5va_ (1d5v A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982999Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 1983000Protein Adipocyte-transcription factor FREAC-11 (s12, fkh-14) [46835] (1 species)
  7. 1983001Species Human (Homo sapiens) [TaxId:9606] [46836] (1 PDB entry)
  8. 1983002Domain d1d5va_: 1d5v A: [16144]

Details for d1d5va_

PDB Entry: 1d5v (more details)

PDB Description: solution structure of the forkhead domain of the adipocyte- transcription factor freac-11 (s12)
PDB Compounds: (A:) s12 transcription factor (fkh-14)

SCOPe Domain Sequences for d1d5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]}
mlvkppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslne
cfvkvprddkkpgkgsywtldpdsynmfengsfl

SCOPe Domain Coordinates for d1d5va_:

Click to download the PDB-style file with coordinates for d1d5va_.
(The format of our PDB-style files is described here.)

Timeline for d1d5va_: