Lineage for d2grpa_ (2grp A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898322Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1898421Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (22 PDB entries)
    identical sequence in many other species
  8. 1898428Domain d2grpa_: 2grp A: [161439]
    Other proteins in same PDB: d2grpb_
    automated match to d1u9ba_

Details for d2grpa_

PDB Entry: 2grp (more details), 2.05 Å

PDB Description: crystal structure of human rangap1-ubc9-y87a
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 I

SCOPe Domain Sequences for d2grpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grpa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]}
msgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl
rmlfkddypssppkckfepplfhpnvapsgtvclsileedkdwrpaitikqillgiqell
nepniqdpaqaeaytiycqnrveyekrvraqakkfap

SCOPe Domain Coordinates for d2grpa_:

Click to download the PDB-style file with coordinates for d2grpa_.
(The format of our PDB-style files is described here.)

Timeline for d2grpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2grpb_