Lineage for d2groa_ (2gro A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642909Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (20 PDB entries)
    identical sequence in many other species
  8. 1642912Domain d2groa_: 2gro A: [161438]
    Other proteins in same PDB: d2grob_
    automated match to d1u9ba_

Details for d2groa_

PDB Entry: 2gro (more details), 1.7 Å

PDB Description: crystal structure of human rangap1-ubc9-n85q
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 I

SCOPe Domain Sequences for d2groa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2groa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]}
msgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl
rmlfkddypssppkckfepplfhpqvypsgtvclsileedkdwrpaitikqillgiqell
nepniqdpaqaeaytiycqnrveyekrvraqakkfap

SCOPe Domain Coordinates for d2groa_:

Click to download the PDB-style file with coordinates for d2groa_.
(The format of our PDB-style files is described here.)

Timeline for d2groa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2grob_