![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.10: Vng1086c-like [140371] (1 family) ![]() homotetramer; comprises two dimers similar to the antidote epsilon subunit dimer automatically mapped to Pfam PF01893 |
![]() | Family a.8.10.1: Vng1086c-like [140372] (1 protein) Pfam PF01893; UPF0058 |
![]() | Protein Nypothetical protein Vng1086c [140373] (1 species) |
![]() | Species Halobacterium salinarium [TaxId:2242] [140374] (1 PDB entry) Uniprot Q9HQM9 1-89 also Halobacterium halobium |
![]() | Domain d2gf4b_: 2gf4 B: [161430] automated match to d2gf4a1 complexed with act, ca |
PDB Entry: 2gf4 (more details), 2.07 Å
SCOPe Domain Sequences for d2gf4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf4b_ a.8.10.1 (B:) Nypothetical protein Vng1086c {Halobacterium salinarium [TaxId: 2242]} mhkdellelheqmvnikdqflgfdhvdetafaayeeldvepshvhksksehkhavfllgn alaaamsedefssag
Timeline for d2gf4b_: