Class b: All beta proteins [48724] (177 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.7: YdcK-like [141583] (2 proteins) part of Pfam PF00132 this is a repeat family; one repeat unit is 2f9c A:267-285 found in domain |
Protein automated matches [190635] (2 species) not a true protein |
Species Salmonella enterica [TaxId:28901] [187691] (1 PDB entry) |
Domain d2f9cb1: 2f9c B:3-326 [161425] Other proteins in same PDB: d2f9ca1, d2f9cb2 automated match to d2f9ca1 complexed with cs |
PDB Entry: 2f9c (more details), 2.8 Å
SCOPe Domain Sequences for d2f9cb1:
Sequence, based on SEQRES records: (download)
>d2f9cb1 b.81.1.7 (B:3-326) automated matches {Salmonella enterica [TaxId: 28901]} kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre ecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatithafi ehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehalieg ncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddnt ihlrgpkvingedritrtplvgsl
>d2f9cb1 b.81.1.7 (B:3-326) automated matches {Salmonella enterica [TaxId: 28901]} kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre ecaiygdarvlnqseilaiilqiydratvnhsrivhqvqlygnatithafiehraevfdf aliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehaliegncvlkhhvl vgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddntihlrgpkvi ngedritrtplvgsl
Timeline for d2f9cb1: