Lineage for d2f9cb_ (2f9c B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962569Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962570Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 962798Family b.81.1.7: YdcK-like [141583] (2 proteins)
    part of Pfam PF00132
    this is a repeat family; one repeat unit is 2f9c A:267-285 found in domain
  6. 962802Protein automated matches [190635] (2 species)
    not a true protein
  7. 962803Species Salmonella enterica [TaxId:28901] [187691] (1 PDB entry)
  8. 962804Domain d2f9cb_: 2f9c B: [161425]
    Other proteins in same PDB: d2f9ca1
    automated match to d2f9ca1
    complexed with cs

Details for d2f9cb_

PDB Entry: 2f9c (more details), 2.8 Å

PDB Description: Crystal structure of YDCK from Salmonella cholerae. NESG target SCR6
PDB Compounds: (B:) Hypothetical protein YDCK

SCOPe Domain Sequences for d2f9cb_:

Sequence, based on SEQRES records: (download)

>d2f9cb_ b.81.1.7 (B:) automated matches {Salmonella enterica [TaxId: 28901]}
kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
ecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatithafi
ehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehalieg
ncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddnt
ihlrgpkvingedritrtplvgsllehh

Sequence, based on observed residues (ATOM records): (download)

>d2f9cb_ b.81.1.7 (B:) automated matches {Salmonella enterica [TaxId: 28901]}
kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
ecaiygdarvlnqseilaiilqiydratvnhsrivhqvqlygnatithafiehraevfdf
aliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehaliegncvlkhhvl
vgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddntihlrgpkvi
ngedritrtplvgsllehh

SCOPe Domain Coordinates for d2f9cb_:

Click to download the PDB-style file with coordinates for d2f9cb_.
(The format of our PDB-style files is described here.)

Timeline for d2f9cb_: