Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.13: Linker histone H1/H5 [46827] (4 proteins) automatically mapped to Pfam PF00538 |
Protein Histone H1, globular domain [46830] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [46831] (1 PDB entry) |
Domain d1ghca_: 1ghc A: [16142] |
PDB Entry: 1ghc (more details)
SCOPe Domain Sequences for d1ghca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghca_ a.4.5.13 (A:) Histone H1, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} magpsvtelitkavsaskerkglslaalkkalaaggydveknnsriklglkslvskgtlv qtkgtgasgsfrlsk
Timeline for d1ghca_: