SCOPe 2.01: Domain d2ekeb_: 2eke B:

Lineage for d2ekeb_ (2eke B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187672] (2 PDB entries)

8. Domain d2ekeb_: 2eke B: [161414]
   Other proteins in same PDB: d2ekec1, d2eked1
   automated match to d1a3sa_

Details for d2ekeb_

PDB Entry: 2eke, 1.9 Å

PDB Description: Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway

PDB Compounds: (B:) SUMO-conjugating enzyme UBC9

SCOPe Domain Sequences for d2ekeb_:

Sequence; same for both SEQRES and ATOM records:

>d2ekeb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slclqrlqeerkkwrkdhpfgfyakpvkkadgsmdlqkweagipgkegtnwaggvypitv
eypneypskppkvkfpagfyhpnvypsgticlsilnedqdwrpaitlkqivlgvqdllds
pnpnspaqepawrsfsrnkaeydkkvllqakqys

Timeline for d2ekeb_:

• d2ekeb_ is new in SCOPe 2.01-stable
  
• d2ekeb_ appears in SCOPe 2.02
  
• d2ekeb_ appears in the current release, SCOPe 2.08