Lineage for d2ekea_ (2eke A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898322Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1898325Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187672] (2 PDB entries)
  8. 1898330Domain d2ekea_: 2eke A: [161413]
    Other proteins in same PDB: d2ekec_, d2eked_
    automated match to d1a3sa_

Details for d2ekea_

PDB Entry: 2eke (more details), 1.9 Å

PDB Description: Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway
PDB Compounds: (A:) SUMO-conjugating enzyme UBC9

SCOPe Domain Sequences for d2ekea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ekea_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slclqrlqeerkkwrkdhpfgfyakpvkkadgsmdlqkweagipgkegtnwaggvypitv
eypneypskppkvkfpagfyhpnvypsgticlsilnedqdwrpaitlkqivlgvqdllds
pnpnspaqepawrsfsrnkaeydkkvllqakqys

SCOPe Domain Coordinates for d2ekea_:

Click to download the PDB-style file with coordinates for d2ekea_.
(The format of our PDB-style files is described here.)

Timeline for d2ekea_: