![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187672] (2 PDB entries) |
![]() | Domain d2ekea_: 2eke A: [161413] Other proteins in same PDB: d2ekec1, d2eked1 automated match to d1a3sa_ |
PDB Entry: 2eke (more details), 1.9 Å
SCOPe Domain Sequences for d2ekea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ekea_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} slclqrlqeerkkwrkdhpfgfyakpvkkadgsmdlqkweagipgkegtnwaggvypitv eypneypskppkvkfpagfyhpnvypsgticlsilnedqdwrpaitlkqivlgvqdllds pnpnspaqepawrsfsrnkaeydkkvllqakqys
Timeline for d2ekea_: