Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d2eiza_: 2eiz A: [161412] Other proteins in same PDB: d2eizb1, d2eizb2, d2eizc_ automated match to d1c08a_ mutant |
PDB Entry: 2eiz (more details), 1.9 Å
SCOPe Domain Sequences for d2eiza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eiza_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivmtqspatlsvspgeratlscrasqsignnlhwyqqkpgqaprlliyyasqsisgipa rfsgsgsgteftltisslqsedfavyycqqsnswpytfgggtkveik
Timeline for d2eiza_: