SCOPe 2.01: Domain d2cb2e_: 2cb2 E:

Lineage for d2cb2e_ (2cb2 E:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.17: SOR-like [143278] (2 proteins)
   Pfam PF07682; duplication: consists of two similar domains

6. Protein automated matches [190550] (2 species)
   not a true protein

7. Species Acidianus ambivalens [TaxId:2283] [187530] (1 PDB entry)

8. Domain d2cb2e_: 2cb2 E: [161401]
   Other proteins in same PDB: d2cb2a1
   automated match to d2cb2a1
   complexed with fe

Details for d2cb2e_

PDB Entry: 2cb2, 1.7 Å

PDB Description: sulfur oxygenase reductase from acidianus ambivalens

PDB Compounds: (E:) sulfur oxygenase reductase

SCOPe Domain Sequences for d2cb2e_:

Sequence; same for both SEQRES and ATOM records:

>d2cb2e_ d.58.4.17 (E:) automated matches {Acidianus ambivalens [TaxId: 2283]}
pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
wreylne

Timeline for d2cb2e_:

• d2cb2e_ is new in SCOPe 2.01-stable
  
• d2cb2e_ appears in SCOPe 2.02
  
• d2cb2e_ appears in the current release, SCOPe 2.08