SCOPe 2.08: Domain d1hsta_: 1hst A:

Lineage for d1hsta_ (1hst A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.13: Linker histone H1/H5 [46827] (4 proteins)
   automatically mapped to Pfam PF00538

6. Protein Histone H5, globular domain [46828] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46829] (1 PDB entry)

8. Domain d1hsta_: 1hst A: [16140]

Details for d1hsta_

PDB Entry: 1hst, 2.6 Å

PDB Description: crystal structure of globular domain of histone h5 and its implications for nucleosome binding

PDB Compounds: (A:) histone h5

SCOPe Domain Sequences for d1hsta_:

Sequence; same for both SEQRES and ATOM records:

>d1hsta_ a.4.5.13 (A:) Histone H5, globular domain {Chicken (Gallus gallus) [TaxId: 9031]}
shptysemiaaairaeksrggssrqsiqkyikshykvghnadlqiklsirrllaagvlkq
tkgvgasgsfrlak

Timeline for d1hsta_:

• d1hsta_ first appeared (with stable ids) in SCOP 1.55
  
• d1hsta_ appears in SCOPe 2.07