Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.17: SOR-like [143278] (2 proteins) Pfam PF07682; duplication: consists of two similar domains |
Protein automated matches [190550] (3 species) not a true protein |
Species Acidianus ambivalens [TaxId:2283] [187530] (10 PDB entries) |
Domain d2cb2b_: 2cb2 B: [161398] Other proteins in same PDB: d2cb2a1 automated match to d2cb2a1 complexed with fe |
PDB Entry: 2cb2 (more details), 1.7 Å
SCOPe Domain Sequences for d2cb2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cb2b_ d.58.4.17 (B:) automated matches {Acidianus ambivalens [TaxId: 2283]} pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf wreylne
Timeline for d2cb2b_: