SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2cb2b_ (2cb2 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173123Family d.58.4.17: SOR-like [143278] (2 protein domains)
    Pfam PF07682; duplication: consists of two similar domains
  6. 2173127Protein automated matches [190550] (2 species)
    not a true protein
  7. 2173128Species Acidianus ambivalens [TaxId:2283] [187530] (4 PDB entries)
  8. 2173135Domain d2cb2b_: 2cb2 B: [161398]
    Other proteins in same PDB: d2cb2a1
    automated match to d2cb2a1
    complexed with fe

Details for d2cb2b_

PDB Entry: 2cb2 (more details), 1.7 Å

PDB Description: sulfur oxygenase reductase from acidianus ambivalens
PDB Compounds: (B:) sulfur oxygenase reductase

SCOPe Domain Sequences for d2cb2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cb2b_ d.58.4.17 (B:) automated matches {Acidianus ambivalens [TaxId: 2283]}
pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
wreylne

SCOPe Domain Coordinates for d2cb2b_:

Click to download the PDB-style file with coordinates for d2cb2b_.
(The format of our PDB-style files is described here.)

Timeline for d2cb2b_: