SCOPe 2.05: Domain d2bmed_: 2bme D:

Lineage for d2bmed_ (2bme D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)

8. Domain d2bmed_: 2bme D: [161395]
   automated match to d2bmda1
   complexed with bme, gnp, mg, trs

Details for d2bmed_

PDB Entry: 2bme, 1.57 Å

PDB Description: high resolution structure of gppnhp-bound human rab4a

PDB Compounds: (D:) ras-related protein rab4a

SCOPe Domain Sequences for d2bmed_:

Sequence; same for both SEQRES and ATOM records:

>d2bmed_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqi
wdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgn
kkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkies

Timeline for d2bmed_:

• d2bmed_ first appeared in SCOPe 2.01
  
• d2bmed_ appears in SCOPe 2.04
  
• d2bmed_ appears in SCOPe 2.06
  
• d2bmed_ appears in the current release, SCOPe 2.08