SCOPe 2.03: Domain d2bl8b_: 2bl8 B:

Lineage for d2bl8b_ (2bl8 B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.8: Bacteriocin immunity protein-like [109797] (2 families)

5. Family a.29.8.2: EntA-Im [140475] (2 proteins)

6. Protein automated matches [190515] (1 species)
   not a true protein

7. Species Enterococcus faecium [TaxId:1352] [187470] (1 PDB entry)

8. Domain d2bl8b_: 2bl8 B: [161392]
   Other proteins in same PDB: d2bl8a1
   automated match to d2bl8a1
   complexed with flc

Details for d2bl8b_

PDB Entry: 2bl8, 1.6 Å

PDB Description: 1.6 angstrom crystal structure of enta-im: a bacterial immunity protein conferring immunity to the antimicrobial activity of the pediocin-like bacteriocin, enterocin a

PDB Compounds: (B:) enterocine a immunity protein

SCOPe Domain Sequences for d2bl8b_:

Sequence; same for both SEQRES and ATOM records:

>d2bl8b_ a.29.8.2 (B:) automated matches {Enterococcus faecium [TaxId: 1352]}
nakqivhelyndisiskdpkysdilevlqkvylklekqkyeldpsplinrlvnylyftay
tnkirfteyqeelirnlseigr

Timeline for d2bl8b_:

• d2bl8b_ first appeared in SCOPe 2.01
  
• d2bl8b_ appears in SCOPe 2.02
  
• d2bl8b_ appears in SCOPe 2.04
  
• d2bl8b_ appears in the current release, SCOPe 2.08