| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.8: Bacteriocin immunity protein-like [109797] (2 families) ![]() |
| Family a.29.8.2: EntA-Im [140475] (2 proteins) |
| Protein automated matches [190515] (1 species) not a true protein |
| Species Enterococcus faecium [TaxId:1352] [187470] (1 PDB entry) |
| Domain d2bl8b_: 2bl8 B: [161392] Other proteins in same PDB: d2bl8a1 automated match to d2bl8a1 complexed with flc |
PDB Entry: 2bl8 (more details), 1.6 Å
SCOPe Domain Sequences for d2bl8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bl8b_ a.29.8.2 (B:) automated matches {Enterococcus faecium [TaxId: 1352]}
nakqivhelyndisiskdpkysdilevlqkvylklekqkyeldpsplinrlvnylyftay
tnkirfteyqeelirnlseigr
Timeline for d2bl8b_: