| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.12: Restriction endonuclease FokI, N-terminal (recognition) domain [46824] (1 protein) |
| Protein Restriction endonuclease FokI, N-terminal (recognition) domain [46825] (1 species) duplication: consists of three elaborated "winged helix" domains |
| Species Flavobacterium okeanokoites [TaxId:244] [46826] (2 PDB entries) |
| Domain d1foka3: 1fok A:287-386 [16139] Other proteins in same PDB: d1foka4 protein/DNA complex |
PDB Entry: 1fok (more details), 2.8 Å
SCOPe Domain Sequences for d1foka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1foka3 a.4.5.12 (A:287-386) Restriction endonuclease FokI, N-terminal (recognition) domain {Flavobacterium okeanokoites [TaxId: 244]}
vpkrvywemlatnltdkeyvrtrralileilikagslkieqiqdnlkklgfdevietien
dikglintgifieikgrfyqlkdhilqfvipnrgvtkqlv
Timeline for d1foka3: