Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (11 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries) |
Domain d2aq1a_: 2aq1 A: [161385] Other proteins in same PDB: d2aq1b1, d2aq1b2, d2aq1d1, d2aq1d2, d2aq1f1, d2aq1f2, d2aq1h1, d2aq1h2 automated match to d2aq2a1 mutant |
PDB Entry: 2aq1 (more details), 2.1 Å
SCOPe Domain Sequences for d2aq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq1a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip dgyeasrpsqeqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
Timeline for d2aq1a_: