Lineage for d2afke_ (2afk E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477146Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2477361Protein Nitrogenase iron protein [52661] (3 species)
  7. 2477365Species Azotobacter vinelandii [TaxId:354] [52662] (25 PDB entries)
  8. 2477394Domain d2afke_: 2afk E: [161380]
    Other proteins in same PDB: d2afka_, d2afkb_, d2afkc_, d2afkd_
    automated match to d1fp6a_
    complexed with acp, ca, cfn, clf, hca, mg, sf4

Details for d2afke_

PDB Entry: 2afk (more details), 2.3 Å

PDB Description: Crystal Structure of MgAMPPCP-bound Av2-Av1 complex
PDB Compounds: (E:) nitrogenase iron protein 1

SCOPe Domain Sequences for d2afke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afke_ c.37.1.10 (E:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellme

SCOPe Domain Coordinates for d2afke_:

Click to download the PDB-style file with coordinates for d2afke_.
(The format of our PDB-style files is described here.)

Timeline for d2afke_: