SCOPe 2.06: Domain d1foka2: 1fok A:144-281

Lineage for d1foka2 (1fok A:144-281)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.12: Restriction endonuclease FokI, N-terminal (recognition) domain [46824] (1 protein)

6. Protein Restriction endonuclease FokI, N-terminal (recognition) domain [46825] (1 species)
   duplication: consists of three elaborated "winged helix" domains

7. Species Flavobacterium okeanokoites [TaxId:244] [46826] (2 PDB entries)

8. Domain d1foka2: 1fok A:144-281 [16138]
   Other proteins in same PDB: d1foka4
   protein/DNA complex

Details for d1foka2

PDB Entry: 1fok, 2.8 Å

PDB Description: structure of restriction endonuclease foki bound to dna

PDB Compounds: (A:) protein (foki restriction endonucleas)

SCOPe Domain Sequences for d1foka2:

Sequence, based on SEQRES records:

>d1foka2 a.4.5.12 (A:144-281) Restriction endonuclease FokI, N-terminal (recognition) domain {Flavobacterium okeanokoites [TaxId: 244]}
gsaiekeilieaissyppairiltlledgqhltkfdlgknlgfsgesgftslpegilldt
lanampkdkgeirnnwegssdkyarmiggwldklglvkqgkkefiiptlgkpdnkefish
afkitgeglkvlrrakgs

Sequence, based on observed residues (ATOM records):

>d1foka2 a.4.5.12 (A:144-281) Restriction endonuclease FokI, N-terminal (recognition) domain {Flavobacterium okeanokoites [TaxId: 244]}
gsaiekeilieaissyppairiltlledgqhltkfdlgknlgfsgesgftslpegilldt
lanampkdkgeirnnwegssdkyarmiggwldklglvkqgkkefiiptpdnkefishafk
itgeglkvlrrakgs

Timeline for d1foka2:

• d1foka2 first appeared (with stable ids) in SCOP 1.55
  
• d1foka2 appears in SCOPe 2.05
  
• d1foka2 appears in SCOPe 2.07
  
• d1foka2 appears in the current release, SCOPe 2.08