SCOPe 2.07: Domain d2a5tb_: 2a5t B:

Lineage for d2a5tb_ (2a5t B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)

8. Domain d2a5tb_: 2a5t B: [161379]
   Other proteins in same PDB: d2a5ta_
   automated match to d1pb7a_
   complexed with glu, gly

Details for d2a5tb_

PDB Entry: 2a5t, 2 Å

PDB Description: crystal structure of the nr1/nr2a ligand-binding cores complex

PDB Compounds: (B:) N-methyl-D-aspartate receptor NMDAR2A subunit

SCOPe Domain Sequences for d2a5tb_:

Sequence, based on SEQRES records:

>d2a5tb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgyg
ialqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records):

>d2a5tb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigyifattgygia
lqkgspwkrqidlallqfvgdgemeeletlwltgic

Timeline for d2a5tb_:

• d2a5tb_ first appeared in SCOPe 2.01
  
• d2a5tb_ appears in SCOPe 2.06
  
• d2a5tb_ appears in the current release, SCOPe 2.08