Lineage for d2a5tb_ (2a5t B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145930Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)
  8. 2146027Domain d2a5tb_: 2a5t B: [161379]
    Other proteins in same PDB: d2a5ta_
    automated match to d1pb7a_
    complexed with glu, gly

Details for d2a5tb_

PDB Entry: 2a5t (more details), 2 Å

PDB Description: crystal structure of the nr1/nr2a ligand-binding cores complex
PDB Compounds: (B:) N-methyl-D-aspartate receptor NMDAR2A subunit

SCOPe Domain Sequences for d2a5tb_:

Sequence, based on SEQRES records: (download)

>d2a5tb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgyg
ialqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records): (download)

>d2a5tb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigyifattgygia
lqkgspwkrqidlallqfvgdgemeeletlwltgic

SCOPe Domain Coordinates for d2a5tb_:

Click to download the PDB-style file with coordinates for d2a5tb_.
(The format of our PDB-style files is described here.)

Timeline for d2a5tb_: