Lineage for d1ztpc_ (1ztp C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962753Family d.86.1.2: BLES03-like [143583] (1 protein)
    the N-terminal strand is missing, but there extra C-terminal strands in the beta-sheet
    automatically mapped to Pfam PF08939
  6. 2962754Protein Basophilic leukemia expressed protein BLES03 [143584] (1 species)
  7. 2962755Species Human (Homo sapiens) [TaxId:9606] [143585] (2 PDB entries)
    Uniprot Q9H3H3 17-250
  8. 2962761Domain d1ztpc_: 1ztp C: [161375]
    automated match to d1ztpa1

Details for d1ztpc_

PDB Entry: 1ztp (more details), 2.5 Å

PDB Description: x-ray structure of gene product from homo sapiens hs.433573
PDB Compounds: (C:) Basophilic leukemia expressed protein BLES03

SCOPe Domain Sequences for d1ztpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztpc_ d.86.1.2 (C:) Basophilic leukemia expressed protein BLES03 {Human (Homo sapiens) [TaxId: 9606]}
maadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepvgwiavygqgyspn
sgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapgfkldhawagiara
vvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaagikclltykpdvyt
ylgiyranrwhlcptlyesrfqlggsargsrvldrannvel

SCOPe Domain Coordinates for d1ztpc_:

Click to download the PDB-style file with coordinates for d1ztpc_.
(The format of our PDB-style files is described here.)

Timeline for d1ztpc_: