Lineage for d1znvb_ (1znv B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2155547Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2155548Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2155549Family d.4.1.1: HNH-motif [54061] (3 protein domains)
  6. 2155550Protein DNase domain of colicin E7 [54062] (1 species)
  7. 2155551Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)
  8. 2155555Domain d1znvb_: 1znv B: [161373]
    Other proteins in same PDB: d1znva_, d1znvc_
    automated match to d1mz8b_
    protein/DNA complex; complexed with ni, po4

Details for d1znvb_

PDB Entry: 1znv (more details), 2 Å

PDB Description: How a His-metal finger endonuclease ColE7 binds and cleaves DNA with a transition metal ion cofactor
PDB Compounds: (B:) colicin e7

SCOPe Domain Sequences for d1znvb_:

Sequence, based on SEQRES records: (download)

>d1znvb_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelheekpisqnggvydmdnisvvtpkrh
idihrgk

Sequence, based on observed residues (ATOM records): (download)

>d1znvb_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelheevydmdnisvvtpkrhidihrgk

SCOPe Domain Coordinates for d1znvb_:

Click to download the PDB-style file with coordinates for d1znvb_.
(The format of our PDB-style files is described here.)

Timeline for d1znvb_: