SCOPe 2.07: Domain d1z9sc_: 1z9s C:

Lineage for d1z9sc_ (1z9s C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein F1 capsule antigen Caf1 [89213] (1 species)

7. Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)

8. Domain d1z9sc_: 1z9s C: [161370]
   Other proteins in same PDB: d1z9sa1, d1z9sa2
   automated match to d1p5ub_

Details for d1z9sc_

PDB Entry: 1z9s, 2.2 Å

PDB Description: Crystal Structure of the native chaperone:subunit:subunit Caf1M:Caf1:Caf1 complex

PDB Compounds: (C:) F1 capsule antigen

SCOPe Domain Sequences for d1z9sc_:

Sequence, based on SEQRES records:

>d1z9sc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaagky
tdavtvtvsnq

Sequence, based on observed residues (ATOM records):

>d1z9sc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngenldvvlatgsqdffvrsigskggklaagkytda
vtvtvsnq

Timeline for d1z9sc_:

• d1z9sc_ first appeared in SCOPe 2.01
  
• d1z9sc_ appears in SCOPe 2.06
  
• d1z9sc_ appears in the current release, SCOPe 2.08