Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein beta-Lactoglobulin [50827] (4 species) |
Species Reindeer (Rangifer tarandus) [TaxId:9870] [141461] (1 PDB entry) Uniprot P02755 19-180 |
Domain d1yupe_: 1yup E: [161367] Other proteins in same PDB: d1yupb_, d1yupc_, d1yupd_, d1yupf_, d1yupg_ automated match to d1yupa1 |
PDB Entry: 1yup (more details), 2.1 Å
SCOPe Domain Sequences for d1yupe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yupe_ b.60.1.1 (E:) beta-Lactoglobulin {Reindeer (Rangifer tarandus) [TaxId: 9870]} dldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqkwengkcaq kkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclvrtpev ddeamekfdkalkalpmhirlsfnptqleeqcrv
Timeline for d1yupe_: