Lineage for d1ycjb_ (1ycj B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163929Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)
  8. 2164021Domain d1ycjb_: 1ycj B: [161365]
    Other proteins in same PDB: d1ycja1, d1ycja2
    automated match to d1lb8a_
    complexed with glu, so4

Details for d1ycjb_

PDB Entry: 1ycj (more details), 1.95 Å

PDB Description: crystal structure of the kainate receptor glur5 ligand-binding core in complex with (s)-glutamate
PDB Compounds: (B:) Ionotropic glutamate receptor 5

SCOPe Domain Sequences for d1ycjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycjb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
anrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgky
gaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpid
saddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvl
ttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeeg
klhmmkekwwrgngcp

SCOPe Domain Coordinates for d1ycjb_:

Click to download the PDB-style file with coordinates for d1ycjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ycjb_: