SCOPe 2.08: Domain d1y0ya3: 1y0y A:6-72,A:164-351

Lineage for d1y0ya3 (1y0y A:6-72,A:164-351)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Frv operon protein FrvX, catalytic domain [117659] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [117660] (3 PDB entries)
   Uniprot O59196 # PH1527

8. Domain d1y0ya3: 1y0y A:6-72,A:164-351 [161364]
   Other proteins in same PDB: d1y0ya1
   automatically matched to 1Y0R A:164-351,A:6-72
   complexed with zn

Details for d1y0ya3

PDB Entry: 1y0y, 1.6 Å

PDB Description: Crystal structure of tetrahedral aminopeptidase from P. horikoshii in complex with amastatin

PDB Compounds: (A:) Frv operon protein FrvX

SCOPe Domain Sequences for d1y0ya3:

Sequence; same for both SEQRES and ATOM records:

>d1y0ya3 c.56.5.4 (A:6-72,A:164-351) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
aahmdqiXwdgrlerlgkhrfvsiafddriavytilevakqlkdakadvyfvatvqeevg
lrgartsafgiepdygfaidvtiaadipgtpehkqvthlgkgtaikimdrsvichptivr
wleelakkheipyqleillgggtdagaihltkagvptgalsvparyihsntevvderdvd
atvelmtkalenihel

Timeline for d1y0ya3:

• d1y0ya3 first appeared in SCOPe 2.01
  
• d1y0ya3 appears in SCOPe 2.07